DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and skr-9

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_503043.1 Gene:skr-9 / 178494 WormBaseID:WBGene00004815 Length:194 Species:Caenorhabditis elegans


Alignment Length:152 Identity:41/152 - (26%)
Similarity:74/152 - (48%) Gaps:13/152 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVTPTI-KLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENA-IVPLHSVSTFTLGKILAWA 63
            :|.|.: |:||::|.:|.........|..:..::...|.::..:. .:|:.:|....|..::.|.
 Worm    17 VVAPIMYKVESNDGKVFEISDEAVKQSNILSNLISTCAPEDVASMDPIPITNVIGNILKMVIEWC 81

  Fly    64 NHHKDD----DDQSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYNV 124
            ..||.:    :|.|.      |:. ..:..||..||.:::..|.::|:|...|.:.||:.....:
 Worm    82 EKHKGEALPVEDDSV------PKH-VNVPEWDTNFLKIDNDVLFDLIVACNYLDVPGLMNYGCKI 139

  Fly   125 VANMIRGKTPEEIRFIFNIPED 146
            ||.|..||:|:|:|.||.||.|
 Worm   140 VAMMAIGKSPDELRIIFAIPTD 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 40/150 (27%)
BTB 6..114 CDD:295341 24/113 (21%)
Skp1 88..156 CDD:279768 23/59 (39%)
skr-9NP_503043.1 Skp1 20..129 CDD:214704 25/115 (22%)
Skp1 103..>161 CDD:279768 22/57 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160609
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.