DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and skr-13

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_503042.1 Gene:skr-13 / 178493 WormBaseID:WBGene00004819 Length:172 Species:Caenorhabditis elegans


Alignment Length:143 Identity:42/143 - (29%)
Similarity:73/143 - (51%) Gaps:6/143 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLESSEGVIFPTEVRVAMVSETIKTMLDH--FAVQNDENA-IVPLHSVSTFTLGKILAWANHHKD 68
            |:.||:||:.....:....|:|:..::::  :.::|.|.. .:|:.:|:..|:.|:......||.
 Worm    16 KIISSDGVVSKMSEKAVQQSKTLSNLIENLGYTIENIETRDPIPVTNVNGKTMAKVAELCEKHKA 80

  Fly    69 DDDQSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYNVVANMIRGKT 133
            |   :...:.:...:...|..||..||.:....|.::|||:..|.||||:......|:||.:|||
 Worm    81 D---AIPEDNMNVLKTLTIPEWDQKFLKIEDEALFDLILASNFLDIKGLMYYGCKTVSNMAKGKT 142

  Fly   134 PEEIRFIFNIPED 146
            ..|:|.||.|..|
 Worm   143 TAELREIFGINTD 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 42/143 (29%)
BTB 6..114 CDD:295341 26/109 (24%)
Skp1 88..156 CDD:279768 25/59 (42%)
skr-13NP_503042.1 Skp1 12..123 CDD:214704 26/109 (24%)
SKP1 16..166 CDD:227528 42/143 (29%)
Skp1 97..161 CDD:279768 25/59 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160604
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.