DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and skr-15

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_494662.1 Gene:skr-15 / 173729 WormBaseID:WBGene00004821 Length:184 Species:Caenorhabditis elegans


Alignment Length:149 Identity:38/149 - (25%)
Similarity:71/149 - (47%) Gaps:10/149 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TPTI--KLESSEGVIFPTEVRVAMVSETIKTMLDH--FAVQNDENAI-VPLHSVSTFTLGKILAW 62
            ||.:  .:||::.|:.....:....|.|:...:.:  ::.:|.|:.: :|:..|:..||..::.|
 Worm    16 TPVVYYSIESNDRVVLKISEQAIKQSATLSNSITNLGYSAENAESMVPIPIEKVNGKTLKLVVEW 80

  Fly    63 ANHHKDDDDQSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYNVVAN 127
            ..|||.|     ...|..|.....:..||..|:.:....|.:::.|:..|::..||......:|.
 Worm    81 CEHHKAD-----PVPEAYPSGNTVLPVWDRKFVDIEHDALTDLVNASNFLEVMTLLTYCCKFIAG 140

  Fly   128 MIRGKTPEEIRFIFNIPED 146
            :.:|.:|||:|..|.||.|
 Worm   141 LAKGMSPEEMRVFFCIPTD 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 38/149 (26%)
BTB 6..114 CDD:295341 24/112 (21%)
Skp1 88..156 CDD:279768 18/59 (31%)
skr-15NP_494662.1 Skp1 20..127 CDD:214704 24/111 (22%)
SKP1 23..176 CDD:227528 36/142 (25%)
Skp1 101..167 CDD:279768 18/59 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160615
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.