DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpE and skr-2

DIOPT Version :9

Sequence 1:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_492512.1 Gene:skr-2 / 172773 WormBaseID:WBGene00004808 Length:174 Species:Caenorhabditis elegans


Alignment Length:167 Identity:60/167 - (35%)
Similarity:91/167 - (54%) Gaps:22/167 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDE--NA-IVPLHSVSTFTLGKILAWANHHK 67
            ||:.||:..||.....|..:|.|:.|:|....:.:||  || .:|:.:|:...|.|::.|...|:
 Worm    16 IKISSSDDEIFLVPRNVIRLSNTLNTLLVDLGLDDDEGTNAEPIPVQNVTASILKKVINWCTKHQ 80

  Fly    68 ------DDDDQSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYNVVA 126
                  :|.::.|:|         :|..||..||.::..||.|:||||..|.|||||::....||
 Worm    81 SDPIPTEDSEKKTDG---------SIQDWDKKFLDIDQGTLFELILAANYLDIKGLLDVACQSVA 136

  Fly   127 NMIRGKTPEEIRFIFNIPEDVSPSVDGELR----WKD 159
            |||:||:|:|||..|||.:|.:.....::|    |.|
 Worm   137 NMIKGKSPDEIRRAFNIKDDFTAEEREQIRKENAWCD 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpENP_608359.1 SKP1 3..156 CDD:227528 57/158 (36%)
BTB 6..114 CDD:295341 37/116 (32%)
Skp1 88..156 CDD:279768 32/67 (48%)
skr-2NP_492512.1 SKP1 16..174 CDD:227528 60/167 (36%)
Skp1 16..124 CDD:214704 37/116 (32%)
Skp1 99..172 CDD:279768 33/72 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160617
Domainoid 1 1.000 56 1.000 Domainoid score I7318
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.770

Return to query results.
Submit another query.