DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpC and SKP1

DIOPT Version :9

Sequence 1:NP_608358.1 Gene:SkpC / 32996 FlyBaseID:FBgn0026175 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_010615.3 Gene:SKP1 / 851928 SGDID:S000002736 Length:194 Species:Saccharomyces cerevisiae


Alignment Length:113 Identity:51/113 - (45%)
Similarity:73/113 - (64%) Gaps:7/113 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ENDENAIVPLPKVNAFILSKILTWIYHHKDDDAHGAEGVELSPQSPHDISAWDANFINVDQPTLF 103
            |:|:..::|:|.|.:.:|.|::.|..||:|.:....:..:....:|  :.:||..|:.|||..|:
Yeast    70 EDDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAP--VDSWDREFLKVDQEMLY 132

  Fly   104 EIILAANYLEIKGLVDLCCKTVANMIRGKTPEEIRHTFNI-----PDE 146
            |||||||||.||.|:|..||.||.||||::|||||.||||     |:|
Yeast   133 EIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEE 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpCNP_608358.1 Skp1 6..114 CDD:214704 28/74 (38%)
Skp1 88..>146 CDD:279768 38/62 (61%)
SKP1NP_010615.3 SKP1 3..194 CDD:227528 51/113 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344320
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 154 1.000 Inparanoid score I1094
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - otm46619
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
TreeFam 1 0.960 - -
1110.810

Return to query results.
Submit another query.