DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpC and AT5G42190

DIOPT Version :9

Sequence 1:NP_608358.1 Gene:SkpC / 32996 FlyBaseID:FBgn0026175 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_568603.1 Gene:AT5G42190 / 834224 AraportID:AT5G42190 Length:171 Species:Arabidopsis thaliana


Alignment Length:151 Identity:71/151 - (47%)
Similarity:92/151 - (60%) Gaps:14/151 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLESSDGMIFSTEVRAAKLSETIKTMLEVSAVENDENAIVPLPKVNAFILSKILTWIYHHKD-- 68
            |.|:||||..|..:...|..|:|||.|:|....:|.    :|||.|.:.||||::.:...|.:  
plant     7 ITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDNG----IPLPNVTSKILSKVIEYCKRHVEAA 67

  Fly    69 ------DDAHGAEGVE--LSPQSPHDISAWDANFINVDQPTLFEIILAANYLEIKGLVDLCCKTV 125
                  .||..|....  .|..|..|:..||:.||.|||.|||::|||||||.||||:||.|:||
plant    68 EKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNIKGLLDLTCQTV 132

  Fly   126 ANMIRGKTPEEIRHTFNIPDE 146
            |:||:||||||||.||||.::
plant   133 ADMIKGKTPEEIRKTFNIKND 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpCNP_608358.1 Skp1 6..114 CDD:214704 47/117 (40%)
Skp1 88..>146 CDD:279768 41/57 (72%)
AT5G42190NP_568603.1 BTB_POZ_SKP1 6..136 CDD:349631 57/132 (43%)
Skp1 122..169 CDD:396171 23/32 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.940

Return to query results.
Submit another query.