DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpC and SK11

DIOPT Version :9

Sequence 1:NP_608358.1 Gene:SkpC / 32996 FlyBaseID:FBgn0026175 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_567959.1 Gene:SK11 / 829569 AraportID:AT4G34210 Length:152 Species:Arabidopsis thaliana


Alignment Length:146 Identity:65/146 - (44%)
Similarity:90/146 - (61%) Gaps:12/146 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAPTIKLESSDGMIFSTEVRAAKLSETIKTMLEVSAVENDENAIVPLPKVNAFILSKILTWIYH 65
            |.:..|.|.||||..|..|...|..|:||..|:|...|.:.    :||..|.:.||.|::.:...
plant     1 MSSKMIVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCVADG----IPLANVESKILVKVIEYCKK 61

  Fly    66 HKDDDAHGAEGVELSPQSPHDISAWDANFINVDQPTLFEIILAANYLEIKGLVDLCCKTVANMIR 130
            |..|:|        :|.|..|::.||..|::::|.|:||:|||||||.||.|:||.|:|||:||:
plant    62 HHVDEA--------NPISEEDLNNWDEKFMDLEQSTIFELILAANYLNIKSLLDLTCQTVADMIK 118

  Fly   131 GKTPEEIRHTFNIPDE 146
            ||||||||.||||.::
plant   119 GKTPEEIRSTFNIEND 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpCNP_608358.1 Skp1 6..114 CDD:214704 41/107 (38%)
Skp1 88..>146 CDD:279768 37/57 (65%)
SK11NP_567959.1 Skp1 3..102 CDD:214704 41/110 (37%)
SKP1 5..150 CDD:227528 64/142 (45%)
Skp1 78..150 CDD:279768 37/57 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.940

Return to query results.
Submit another query.