DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpC and SK21

DIOPT Version :9

Sequence 1:NP_608358.1 Gene:SkpC / 32996 FlyBaseID:FBgn0026175 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_567113.1 Gene:SK21 / 825314 AraportID:AT3G61415 Length:351 Species:Arabidopsis thaliana


Alignment Length:143 Identity:47/143 - (32%)
Similarity:73/143 - (51%) Gaps:12/143 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLESSDGMIFSTEVRAAKLSETIKTMLEVSAVENDENAIVPLP-KVNAFILSKILTWIYHHKDD 69
            |.||::||.|...|...|.....|...:....|.:.:|..:.|| :||..:||.|..:...|   
plant    18 IWLETADGSIQQVEQEVAMFCPMICQEVIQKGVGSSKNYAISLPQRVNPAMLSLIFDYCRFH--- 79

  Fly    70 DAHGAEGVELSPQSPHDISAWDANFINVDQPTLFEIILAANYLEIKGLVDLCCKTVANMIRGKTP 134
                    ::..:|..:...:|..||.:|...|.|:..||:.|::|.||||..:.:|.:|.||||
plant    80 --------QVPGRSNKERKVYDEKFIRMDTKRLCELTSAADSLQLKPLVDLTSRALARIIEGKTP 136

  Fly   135 EEIRHTFNIPDEI 147
            ||||..|::||::
plant   137 EEIREIFHLPDDL 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpCNP_608358.1 Skp1 6..114 CDD:214704 29/108 (27%)
Skp1 88..>146 CDD:279768 26/57 (46%)
SK21NP_567113.1 Skp1 15..116 CDD:214704 29/108 (27%)
Skp1 90..153 CDD:279768 27/60 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.