DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpC and SK10

DIOPT Version :9

Sequence 1:NP_608358.1 Gene:SkpC / 32996 FlyBaseID:FBgn0026175 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_566695.1 Gene:SK10 / 821740 AraportID:AT3G21860 Length:152 Species:Arabidopsis thaliana


Alignment Length:146 Identity:57/146 - (39%)
Similarity:78/146 - (53%) Gaps:12/146 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAPTIKLESSDGMIFSTEVRAAKLSETIKTMLEVSAVENDENAIVPLPKVNAFILSKILTWIYH 65
            |....|.|:||||..|..|..||...:||..|.|....:|.    :|||:|...||..::.:...
plant     1 MSTKKIILKSSDGHSFEVEEEAACQCQTIAHMSEDDCTDNG----IPLPEVTGKILEMVIEYCNK 61

  Fly    66 HKDDDAHGAEGVELSPQSPHDISAWDANFINVDQPTLFEIILAANYLEIKGLVDLCCKTVANMIR 130
            |..|.|        :|.|..|:..||..|:...|.|:|::|:|||||.||.|:||.|:|||:||:
plant    62 HHVDAA--------NPCSDEDLKKWDKEFMEKYQSTIFDLIMAANYLNIKSLLDLACQTVADMIK 118

  Fly   131 GKTPEEIRHTFNIPDE 146
            ..|.|..|..|||.::
plant   119 DNTVEHTRKFFNIEND 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpCNP_608358.1 Skp1 6..114 CDD:214704 39/107 (36%)
Skp1 88..>146 CDD:279768 29/57 (51%)
SK10NP_566695.1 SKP1 3..149 CDD:227528 56/144 (39%)
Skp1 4..102 CDD:214704 39/109 (36%)
Skp1 76..149 CDD:279768 29/59 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1010.030

Return to query results.
Submit another query.