DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpC and SK7

DIOPT Version :9

Sequence 1:NP_608358.1 Gene:SkpC / 32996 FlyBaseID:FBgn0026175 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_566693.1 Gene:SK7 / 821738 AraportID:AT3G21840 Length:125 Species:Arabidopsis thaliana


Alignment Length:129 Identity:43/129 - (33%)
Similarity:66/129 - (51%) Gaps:12/129 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAPTIKLESSDGMIFSTEVRAAKLSETIKTMLEVSAVENDENAIVPLPKVNAFILSKILTWIYH 65
            |....|.|:||||.:|..|...|:..:||..|:|....:|    ::|:..|.:.||..::.:...
plant     1 MSTKKIMLKSSDGKMFEIEEETARQCQTIAHMIEAECTDN----VIPVSNVTSEILEMVIEYCNK 61

  Fly    66 HKDDDAHGAEGVELSPQSPHDISAWDANFINVDQPTLFEIILAANYLEIKGLVDLCCKTVANMI 129
            |..|.|        :|.|..|:..||..|:..||.|:|.::.||..|.||.|:.|..:|||:|:
plant    62 HHVDAA--------NPCSDEDLKKWDKEFMEKDQYTIFHLMNAAYDLHIKSLLALAYQTVADMV 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpCNP_608358.1 Skp1 6..114 CDD:214704 34/107 (32%)
Skp1 88..>146 CDD:279768 18/42 (43%)
SK7NP_566693.1 BTB_POZ_SKP1 5..117 CDD:349631 41/123 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.980

Return to query results.
Submit another query.