DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpC and MEO

DIOPT Version :9

Sequence 1:NP_608358.1 Gene:SkpC / 32996 FlyBaseID:FBgn0026175 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_565467.1 Gene:MEO / 816536 AraportID:AT2G20160 Length:150 Species:Arabidopsis thaliana


Alignment Length:156 Identity:45/156 - (28%)
Similarity:75/156 - (48%) Gaps:17/156 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAPTIKLESSDGMIFSTEVRAAKLSETIKTMLEVSAVENDENAIVPLPKVNAFILSKILTWIYH 65
            |.:..|.|.|||...|..:...|:..:.:..|::    ::..:..:.|..|...||:.|:.:...
plant     1 MSSKKIVLTSSDDECFEIDEAVARKMQMVAHMID----DDCADKAIRLQNVTGKILAIIIEYCKK 61

  Fly    66 HKDDDAHGAEGVELSPQSPHDISAWDANFI-NVDQPTLFEIILAANYLEIKGLVDLCCKTVANMI 129
            |.||           .::.::...|||.|: |:|..|||:::.||:||.:.||.:|..:.:|:..
plant    62 HVDD-----------VEAKNEFVTWDAEFVKNIDMDTLFKLLDAADYLIVIGLKNLIAQAIADYT 115

  Fly   130 RGKTPEEIRHTFNIP-DEIPSRTAQL 154
            ..||..|||..|||. |..|....:|
plant   116 ADKTVNEIRELFNIENDYTPEEEEEL 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpCNP_608358.1 Skp1 6..114 CDD:214704 29/108 (27%)
Skp1 88..>146 CDD:279768 25/59 (42%)
MEONP_565467.1 BTB_POZ_SKP1 5..114 CDD:349631 33/123 (27%)
Skp1 102..148 CDD:396171 15/40 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.