DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpC and SK19

DIOPT Version :9

Sequence 1:NP_608358.1 Gene:SkpC / 32996 FlyBaseID:FBgn0026175 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_565295.1 Gene:SK19 / 814845 AraportID:AT2G03160 Length:200 Species:Arabidopsis thaliana


Alignment Length:176 Identity:58/176 - (32%)
Similarity:88/176 - (50%) Gaps:34/176 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAPTIKLESSDGMIFSTEVRAAKLSETIKTMLEVSAVENDENAIVPLPKVNAFILSKILTWIYH 65
            |.:..|.|.||||..|..|...|:..:.:..::|.....|.    :|:|.|...||:|::.:...
plant     1 MSSKKIVLTSSDGESFKVEEVVARKLQIVGHIIEDDCATNK----IPIPNVTGEILAKVIEYCKK 61

  Fly    66 HKDDD----------AHGAEGVELSPQSPHDISA-------------------WDANFI-NVDQP 100
            |.:||          ..|.:.||.:.:.|.|::.                   |||.|: :.|..
plant    62 HVEDDDDVVETHESSTKGDKTVEEAKKKPDDVAVPESTEGDDEAEDKKEKLNEWDAKFMKDFDIK 126

  Fly   101 TLFEIILAANYLEIKGLVDLCCKTVANMIRGKTPEEIRHTFNIPDE 146
            |:|:||||||||.::||.|||.||:|:.|:..||||:|..|||.::
plant   127 TIFDIILAANYLNVQGLFDLCSKTIADYIKDMTPEEVRELFNIEND 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpCNP_608358.1 Skp1 6..114 CDD:214704 40/137 (29%)
Skp1 88..>146 CDD:279768 32/77 (42%)
SK19NP_565295.1 Skp1 3..140 CDD:214704 40/140 (29%)
SKP1 5..187 CDD:227528 57/172 (33%)
Skp1 114..187 CDD:279768 32/59 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - mtm992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.