DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpC and SKP1

DIOPT Version :9

Sequence 1:NP_608358.1 Gene:SkpC / 32996 FlyBaseID:FBgn0026175 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_733779.1 Gene:SKP1 / 6500 HGNCID:10899 Length:163 Species:Homo sapiens


Alignment Length:144 Identity:83/144 - (57%)
Similarity:103/144 - (71%) Gaps:2/144 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PTIKLESSDGMIFSTEVRAAKLSETIKTMLEVSAVEND-ENAIVPLPKVNAFILSKILTWIYHHK 67
            |:|||:||||.||..:|..||.|.|||||||...:::: ::..||||.|||.||.|::.|..|||
Human     2 PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHK 66

  Fly    68 DDDAHGAEGVELSPQSPHDISAWDANFINVDQPTLFEIILAANYLEIKGLVDLCCKTVANMIRGK 132
            ||.. ..|..|...:...||..||..|:.|||.||||:|||||||:||||:|:.||||||||:||
Human    67 DDPP-PPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGK 130

  Fly   133 TPEEIRHTFNIPDE 146
            ||||||.||||.::
Human   131 TPEEIRKTFNIKND 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpCNP_608358.1 Skp1 6..114 CDD:214704 57/108 (53%)
Skp1 88..>146 CDD:279768 42/57 (74%)
SKP1NP_733779.1 BTB_POZ_SKP1 4..127 CDD:349631 68/123 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..83 7/20 (35%)
Interaction with the F-box domain of F-box proteins. /evidence=ECO:0000250 104..163 32/41 (78%)
Skp1 113..160 CDD:396171 24/32 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149263
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.