DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpC and SkpD

DIOPT Version :9

Sequence 1:NP_608358.1 Gene:SkpC / 32996 FlyBaseID:FBgn0026175 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster


Alignment Length:158 Identity:135/158 - (85%)
Similarity:145/158 - (91%) Gaps:0/158 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAPTIKLESSDGMIFSTEVRAAKLSETIKTMLEVSAVENDENAIVPLPKVNAFILSKILTWIYH 65
            |||||||||||||:||||||:|||||||||||||||||||||||:|||||||||||:|||||.||
  Fly     1 MDAPTIKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENAVVPLPKVNAFILNKILTWAYH 65

  Fly    66 HKDDDAHGAEGVELSPQSPHDISAWDANFINVDQPTLFEIILAANYLEIKGLVDLCCKTVANMIR 130
            |||||...|||.||:||||||||.|||||||||||.||||.:||||||||||.||||||:|||||
  Fly    66 HKDDDDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLCCKTLANMIR 130

  Fly   131 GKTPEEIRHTFNIPDEIPSRTAQLGEDL 158
            ||||||||.||||.|::|..||:|||||
  Fly   131 GKTPEEIRQTFNIEDDLPIDTAELGEDL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpCNP_608358.1 Skp1 6..114 CDD:214704 93/107 (87%)
Skp1 88..>146 CDD:279768 49/57 (86%)
SkpDNP_608357.2 Skp1 6..114 CDD:214704 93/107 (87%)
Skp1 88..>147 CDD:279768 50/58 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452330
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - otm46619
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
1211.860

Return to query results.
Submit another query.