DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpC and skr-5

DIOPT Version :9

Sequence 1:NP_608358.1 Gene:SkpC / 32996 FlyBaseID:FBgn0026175 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_507393.1 Gene:skr-5 / 180148 WormBaseID:WBGene00004811 Length:145 Species:Caenorhabditis elegans


Alignment Length:141 Identity:52/141 - (36%)
Similarity:83/141 - (58%) Gaps:7/141 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLESSDGMIFSTEVRAAKLSETIKTMLEVSAVENDENAIVPLPKVNAFILSKILTWIYHHKDDD 70
            :|:.:||.:.|....:.|..|:.:...:.::..|.     :||..|.:.|..|::.|..:|.:|.
 Worm     8 VKIVTSDDVEFIVSPKIANQSKLLADFVVLNQREP-----IPLKNVTSEIFKKVIEWCEYHAEDI 67

  Fly    71 AHGAEGVELSPQSPHDISAWDANFINVDQPTLFEIILAANYLEIKGLVDLCCKTVANMIRGKTPE 135
            ....:.||  .:...||..||..|:.||:.||||::|||.||:||||.::.||::||.|:||:||
 Worm    68 PKPPDNVE--EKRTDDIGEWDVEFLKVDKGTLFELVLAATYLDIKGLFNVTCKSIANSIKGKSPE 130

  Fly   136 EIRHTFNIPDE 146
            |||..||:.:|
 Worm   131 EIRAVFNLGNE 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpCNP_608358.1 Skp1 6..114 CDD:214704 33/107 (31%)
Skp1 88..>146 CDD:279768 32/57 (56%)
skr-5NP_507393.1 Skp1 5..109 CDD:214704 33/107 (31%)
Skp1 84..>141 CDD:279768 32/56 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160634
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.770

Return to query results.
Submit another query.