DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpC and skr-3

DIOPT Version :9

Sequence 1:NP_608358.1 Gene:SkpC / 32996 FlyBaseID:FBgn0026175 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_507059.1 Gene:skr-3 / 180081 WormBaseID:WBGene00004809 Length:167 Species:Caenorhabditis elegans


Alignment Length:144 Identity:64/144 - (44%)
Similarity:89/144 - (61%) Gaps:7/144 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLESSDGMIFSTEVRAAKLSETIKTMLEVSAVENDENA---IVPLPKVNAFILSKILTWIYHHK 67
            |||.|||...|:...:....|:||..:::...:|...:.   .:||.||.:.||.||:||..||.
 Worm    10 IKLTSSDDKTFTVSRKVISQSKTITDIIQNLGIEESGSTSEDTIPLQKVTSTILEKIITWCEHHA 74

  Fly    68 DDDAHGAEGVELSPQSPHDISAWDANFINVDQPTLFEIILAANYLEIKGLVDLCCKTVANMIRGK 132
            ||:....:    ..:...|||.|||.|:.|||.||||||||||||:|:||:|:..:.||||::||
 Worm    75 DDEPKKVD----ENKKTVDISEWDAEFMKVDQGTLFEIILAANYLDIRGLLDVTTQNVANMMKGK 135

  Fly   133 TPEEIRHTFNIPDE 146
            ||.:||..|||.::
 Worm   136 TPSQIRTLFNIEND 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpCNP_608358.1 Skp1 6..114 CDD:214704 47/110 (43%)
Skp1 88..>146 CDD:279768 37/57 (65%)
skr-3NP_507059.1 Skp1 7..117 CDD:214704 47/110 (43%)
SKP1 10..167 CDD:227528 64/144 (44%)
Skp1 91..165 CDD:279768 37/59 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160623
Domainoid 1 1.000 56 1.000 Domainoid score I7318
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.