DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpC and skr-8

DIOPT Version :9

Sequence 1:NP_608358.1 Gene:SkpC / 32996 FlyBaseID:FBgn0026175 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_503044.1 Gene:skr-8 / 178495 WormBaseID:WBGene00004814 Length:194 Species:Caenorhabditis elegans


Alignment Length:166 Identity:58/166 - (34%)
Similarity:88/166 - (53%) Gaps:21/166 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DAPTI-----KLESSDGMIFSTEVRAAKLSETIKTMLEVSAVENDENAIVPLP--KVNAFILSKI 59
            :||.:     |:||:||.:|.....|.|.|..:..::...|.| |..::.|:|  .|...||..:
 Worm    14 EAPVVAPIMYKVESNDGKVFEISDEAVKQSNILSNLISTCAPE-DVASMDPIPITNVTGNILKMV 77

  Fly    60 LTWIYHHKDDDAHGAEGVELSPQS-PHDISA--WDANFINVDQPTLFEIILAANYLEIKGLVDLC 121
            :.|...||      .|.:.:...| |.:|:.  ||.||:.:|...||::|:|.|||::.||::..
 Worm    78 IEWCEKHK------GEALPVEDDSVPKNINVPEWDTNFLKIDNEVLFDLIVACNYLDVPGLMNYG 136

  Fly   122 CKTVANMIRGKTPEEIRHTFNIP----DEIPSRTAQ 153
            ||.||||..||:|:|:|..|.||    ||...|.|:
 Worm   137 CKMVANMAIGKSPDELRIIFAIPTDEEDEAAERAAK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpCNP_608358.1 Skp1 6..114 CDD:214704 36/117 (31%)
Skp1 88..>146 CDD:279768 28/63 (44%)
skr-8NP_503044.1 Skp1 20..129 CDD:214704 36/115 (31%)
Skp1 103..>161 CDD:279768 28/57 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160624
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.