DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpC and skr-9

DIOPT Version :9

Sequence 1:NP_608358.1 Gene:SkpC / 32996 FlyBaseID:FBgn0026175 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_503043.1 Gene:skr-9 / 178494 WormBaseID:WBGene00004815 Length:194 Species:Caenorhabditis elegans


Alignment Length:164 Identity:57/164 - (34%)
Similarity:86/164 - (52%) Gaps:17/164 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DAPTI-----KLESSDGMIFSTEVRAAKLSETIKTMLEVSAVENDENAIVPLPKVNAF--ILSKI 59
            :||.:     |:||:||.:|.....|.|.|..:..::...|.| |..::.|:|..|..  ||..:
 Worm    14 EAPVVAPIMYKVESNDGKVFEISDEAVKQSNILSNLISTCAPE-DVASMDPIPITNVIGNILKMV 77

  Fly    60 LTWIYHHKDDDAHGAEGVELSPQSPH-DISAWDANFINVDQPTLFEIILAANYLEIKGLVDLCCK 123
            :.|...||.:    |..||......| ::..||.||:.:|...||::|:|.|||::.||::..||
 Worm    78 IEWCEKHKGE----ALPVEDDSVPKHVNVPEWDTNFLKIDNDVLFDLIVACNYLDVPGLMNYGCK 138

  Fly   124 TVANMIRGKTPEEIRHTFNIP----DEIPSRTAQ 153
            .||.|..||:|:|:|..|.||    ||...|.|:
 Worm   139 IVAMMAIGKSPDELRIIFAIPTDEEDEAAERAAK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpCNP_608358.1 Skp1 6..114 CDD:214704 36/115 (31%)
Skp1 88..>146 CDD:279768 27/61 (44%)
skr-9NP_503043.1 Skp1 20..129 CDD:214704 36/113 (32%)
Skp1 103..>161 CDD:279768 27/57 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160627
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.