DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpC and skr-13

DIOPT Version :9

Sequence 1:NP_608358.1 Gene:SkpC / 32996 FlyBaseID:FBgn0026175 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_503042.1 Gene:skr-13 / 178493 WormBaseID:WBGene00004819 Length:172 Species:Caenorhabditis elegans


Alignment Length:171 Identity:55/171 - (32%)
Similarity:83/171 - (48%) Gaps:31/171 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DAP----TIKLESSDGMIFSTEVRAAKLSETIKTMLE--VSAVENDENA-IVPLPKVNAFILSKI 59
            |||    ..|:.||||::.....:|.:.|:|:..::|  ...:||.|.. .:|:..||...::|:
 Worm     7 DAPAAEIVYKIISSDGVVSKMSEKAVQQSKTLSNLIENLGYTIENIETRDPIPVTNVNGKTMAKV 71

  Fly    60 LTWIYHHKDDDAHGAEGVELSPQSPHD---------ISAWDANFINVDQPTLFEIILAANYLEIK 115
            ......||.|            ..|.|         |..||..|:.::...||::|||:|:|:||
 Worm    72 AELCEKHKAD------------AIPEDNMNVLKTLTIPEWDQKFLKIEDEALFDLILASNFLDIK 124

  Fly   116 GLVDLCCKTVANMIRGKTPEEIRHTFNI---PDEIPSRTAQ 153
            ||:...||||:||.:|||..|:|..|.|   ..:....|||
 Worm   125 GLMYYGCKTVSNMAKGKTTAELREIFGINTDEQDAAEETAQ 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpCNP_608358.1 Skp1 6..114 CDD:214704 32/119 (27%)
Skp1 88..>146 CDD:279768 27/60 (45%)
skr-13NP_503042.1 Skp1 12..123 CDD:214704 32/122 (26%)
SKP1 16..166 CDD:227528 52/162 (32%)
Skp1 97..161 CDD:279768 27/63 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160622
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.