DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpC and skr-10

DIOPT Version :9

Sequence 1:NP_608358.1 Gene:SkpC / 32996 FlyBaseID:FBgn0026175 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_502902.1 Gene:skr-10 / 178447 WormBaseID:WBGene00004816 Length:192 Species:Caenorhabditis elegans


Alignment Length:166 Identity:59/166 - (35%)
Similarity:86/166 - (51%) Gaps:27/166 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 APTI-KLESSDGMIFSTEVRAAKLSETIKTMLEVSAVENDENAIVPLP--KVNAFILSKILTWIY 64
            ||.: |:||:||.:|.....|.|.|.|:..::...|.| |..::.|:|  .|...||..::.|..
 Worm    17 APIMYKVESNDGTVFEISDEAVKQSNTLSNLISTCAPE-DVASMDPIPITNVTGNILKMVIEWCE 80

  Fly    65 HHK------DDDAHGAEGVELSPQSPHDISA--WDANFINVDQPTLFEIILAANYLEIKGLVDLC 121
            .||      |||:           .|..|:.  ||.||:.:|...||::|:|.|||::.||::..
 Worm    81 KHKGEALPVDDDS-----------VPKHITVPEWDTNFLKIDNEVLFDLIVACNYLDVPGLMNYG 134

  Fly   122 CKTVANMIRGKTPEEIRHTFNIP----DEIPSRTAQ 153
            ||.||.|..||:|:|:|..|.||    ||...|.|:
 Worm   135 CKMVAMMAIGKSPDELRIIFAIPTDEEDEAAERAAK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpCNP_608358.1 Skp1 6..114 CDD:214704 38/118 (32%)
Skp1 88..>146 CDD:279768 27/63 (43%)
skr-10NP_502902.1 Skp1 18..127 CDD:214704 39/120 (33%)
Skp1 101..>159 CDD:279768 27/57 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160625
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.