DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpC and skr-15

DIOPT Version :9

Sequence 1:NP_608358.1 Gene:SkpC / 32996 FlyBaseID:FBgn0026175 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_494662.1 Gene:skr-15 / 173729 WormBaseID:WBGene00004821 Length:184 Species:Caenorhabditis elegans


Alignment Length:155 Identity:50/155 - (32%)
Similarity:83/155 - (53%) Gaps:11/155 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LESSDGMIFSTEVRAAKLSETIK---TMLEVSAVENDENAI-VPLPKVNAFILSKILTWIYHHKD 68
            :||:|.::.....:|.|.|.|:.   |.|..|| ||.|:.: :|:.|||...|..::.|..|||.
 Worm    23 IESNDRVVLKISEQAIKQSATLSNSITNLGYSA-ENAESMVPIPIEKVNGKTLKLVVEWCEHHKA 86

  Fly    69 DDAHGAEGVELSPQSPHDISAWDANFINVDQPTLFEIILAANYLEIKGLVDLCCKTVANMIRGKT 133
            |..     .|..|.....:..||..|::::...|.:::.|:|:||:..|:..|||.:|.:.:|.:
 Worm    87 DPV-----PEAYPSGNTVLPVWDRKFVDIEHDALTDLVNASNFLEVMTLLTYCCKFIAGLAKGMS 146

  Fly   134 PEEIRHTFNIP-DEIPSRTAQLGED 157
            |||:|..|.|| ||...:..:.|::
 Worm   147 PEEMRVFFCIPTDEEDEKAERFGKE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpCNP_608358.1 Skp1 6..114 CDD:214704 33/109 (30%)
Skp1 88..>146 CDD:279768 21/58 (36%)
skr-15NP_494662.1 Skp1 20..127 CDD:214704 33/109 (30%)
SKP1 23..176 CDD:227528 50/155 (32%)
Skp1 101..167 CDD:279768 23/65 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160633
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.