DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and SKP1

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_010615.3 Gene:SKP1 / 851928 SGDID:S000002736 Length:194 Species:Saccharomyces cerevisiae


Alignment Length:195 Identity:65/195 - (33%)
Similarity:97/195 - (49%) Gaps:40/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAPTIKLESSDGVIFSTEVKAAKLSETIKTML--------------------EVSAV------- 38
            |....:.|.|.:|..|:.:.|.|:.|..:|..|                    |.:..       
Yeast     1 MVTSNVVLVSGEGERFTVDKKIAERSLLLKNYLNDMHDSNLQNNSDSESDSDSETNHKSKDNNNG 65

  Fly    39 ----ENDENAVVPLPKVNAFILNKILTWAYHHKDDDDQAAEGEELTPQSPHDISPWDANFINVDQ 99
                |:|:..|:|:|.|.:.:|.|::.||.||:|.:....:.::....:|  :..||..|:.|||
Yeast    66 DDDDEDDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAP--VDSWDREFLKVDQ 128

  Fly   100 PILFEITVAANYLEIKGLEDLCCKTLANMIRGKTPEEIRQTFNIEDDL-PIDTA------ELGED 157
            .:|:||.:|||||.||.|.|..||.:|.||||::|||||:||||.:|. |.:.|      |..||
Yeast   129 EMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEEEAAIRRENEWAED 193

  Fly   158  157
            Yeast   194  193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 38/138 (28%)
Skp1 88..>147 CDD:279768 34/58 (59%)
SKP1NP_010615.3 SKP1 3..194 CDD:227528 64/193 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344322
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 154 1.000 Inparanoid score I1094
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - otm46619
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
TreeFam 1 0.960 - -
1110.810

Return to query results.
Submit another query.