DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and SKP1

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_565123.1 Gene:SKP1 / 843928 AraportID:AT1G75950 Length:160 Species:Arabidopsis thaliana


Alignment Length:153 Identity:70/153 - (45%)
Similarity:92/153 - (60%) Gaps:4/153 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAPTIKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENAVVPLPKVNAFILNKILTWAYH 65
            |.|..|.|:||||..|..|...|..|:||..|:|...|:|.    ||||.|.:.||.|::.:...
plant     1 MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNG----VPLPNVTSKILAKVIEYCKR 61

  Fly    66 HKDDDDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLCCKTLANMIR 130
            |.:.....||..|....|..|:..|||:|:.:||..|||:.:|||||.||.|.||.|:|:|:||:
plant    62 HVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIK 126

  Fly   131 GKTPEEIRQTFNIEDDLPIDTAE 153
            ||||||||.||||::|...:..|
plant   127 GKTPEEIRTTFNIKNDFTPEEEE 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 44/107 (41%)
Skp1 88..>147 CDD:279768 36/58 (62%)
SKP1NP_565123.1 BTB_POZ_SKP1 5..125 CDD:349631 52/123 (42%)
Skp1 111..158 CDD:396171 23/39 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.940

Return to query results.
Submit another query.