DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and SK18

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_563864.2 Gene:SK18 / 837562 AraportID:AT1G10230 Length:158 Species:Arabidopsis thaliana


Alignment Length:159 Identity:55/159 - (34%)
Similarity:87/159 - (54%) Gaps:10/159 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAPTIKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENAVVPLPKVNAFILNKILTWAYH 65
            |.:..|.|.||||..|..:...|:....|..|:|    :|.....:||..|...||:||:.:|..
plant     1 MSSNKILLTSSDGESFEIDEAVARKFLIIVHMME----DNCAGEAIPLENVTGDILSKIIEYAKM 61

  Fly    66 HKDDDDQAAEGEELTPQSPHDISPWDANFI-NVDQPILFEITVAANYLEIKGLEDLCCKTLANMI 129
            |.::..:..|.||    :..::..|||.|: .:|...:|:|.:|||||..:||.....:|:|:.|
plant    62 HVNEPSEEDEDEE----AKKNLDSWDAKFMEKLDLETIFKIILAANYLNFEGLLGFASQTVADYI 122

  Fly   130 RGKTPEEIRQTFNIEDDL-PIDTAELGED 157
            :.|||||:|:.||||:|. |.:..|:.::
plant   123 KDKTPEEVREIFNIENDFTPEEEEEIRKE 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 36/108 (33%)
Skp1 88..>147 CDD:279768 27/59 (46%)
SK18NP_563864.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.890

Return to query results.
Submit another query.