DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and AT5G42190

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_568603.1 Gene:AT5G42190 / 834224 AraportID:AT5G42190 Length:171 Species:Arabidopsis thaliana


Alignment Length:162 Identity:69/162 - (42%)
Similarity:94/162 - (58%) Gaps:22/162 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENAVVPLPKVNAFILNKILTWAYHHKDDD 70
            |.|:||||..|..:...|..|:|||.|:|....:|.    :|||.|.:.||:|::.:...|.   
plant     7 ITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDNG----IPLPNVTSKILSKVIEYCKRHV--- 64

  Fly    71 DQAAEGEELTP--------------QSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLC 121
             :|||..|.|.              .|..|:..||:.||.|||..||::.:|||||.||||.||.
plant    65 -EAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNIKGLLDLT 128

  Fly   122 CKTLANMIRGKTPEEIRQTFNIEDDLPIDTAE 153
            |:|:|:||:||||||||:||||::|...:..|
plant   129 CQTVADMIKGKTPEEIRKTFNIKNDFTPEEEE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 44/121 (36%)
Skp1 88..>147 CDD:279768 37/58 (64%)
AT5G42190NP_568603.1 BTB_POZ_SKP1 6..136 CDD:349631 53/136 (39%)
Skp1 122..169 CDD:396171 24/39 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.940

Return to query results.
Submit another query.