DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and SK11

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_567959.1 Gene:SK11 / 829569 AraportID:AT4G34210 Length:152 Species:Arabidopsis thaliana


Alignment Length:154 Identity:65/154 - (42%)
Similarity:89/154 - (57%) Gaps:14/154 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAPTIKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENAVVPLPKVNAFILNKILTWA-Y 64
            |.:..|.|.||||..|..|...|..|:||..|:|...|.:.    :||..|.:.||.|::.:. .
plant     1 MSSKMIVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCVADG----IPLANVESKILVKVIEYCKK 61

  Fly    65 HHKDDDDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLCCKTLANMI 129
            ||.|         |..|.|..|::.||..|::::|..:||:.:|||||.||.|.||.|:|:|:||
plant    62 HHVD---------EANPISEEDLNNWDEKFMDLEQSTIFELILAANYLNIKSLLDLTCQTVADMI 117

  Fly   130 RGKTPEEIRQTFNIEDDLPIDTAE 153
            :||||||||.|||||:|...:..|
plant   118 KGKTPEEIRSTFNIENDFTPEEEE 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 39/108 (36%)
Skp1 88..>147 CDD:279768 34/58 (59%)
SK11NP_567959.1 Skp1 3..102 CDD:214704 39/111 (35%)
SKP1 5..150 CDD:227528 64/150 (43%)
Skp1 78..150 CDD:279768 36/64 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.940

Return to query results.
Submit another query.