DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and SK5

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_567091.1 Gene:SK5 / 825172 AraportID:AT3G60020 Length:153 Species:Arabidopsis thaliana


Alignment Length:154 Identity:56/154 - (36%)
Similarity:83/154 - (53%) Gaps:25/154 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENAVVPLPKVNAFILNKILTWAYHHKDDD 70
            |.|:||||..|..:...|:.|..|..|:|.....:    |:||..|.:.||..::.:...|....
plant     5 IMLKSSDGKSFEIDEDVARKSIAINHMVEDGCATD----VIPLRNVTSKILKIVIDYCEKHVKSK 65

  Fly    71 DQAAEGEELTPQSPHDISPWDANFI-NVDQPILFEITVAANYLEIKGLEDLCCKTL-----ANMI 129
            ::            .|:..|||:|: .::..|||::.:|||||.|:.|.||.|||:     |:::
plant    66 EE------------EDLKEWDADFMKTIETTILFDVMMAANYLNIQSLLDLTCKTVSDLLQADLL 118

  Fly   130 RGKTPEEIRQTFNIEDDLPIDTAE 153
            .||||:|||..||||:||   |||
plant   119 SGKTPDEIRAHFNIENDL---TAE 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 32/108 (30%)
Skp1 88..>147 CDD:279768 31/64 (48%)
SK5NP_567091.1 BTB_POZ_SKP1 4..112 CDD:349631 39/122 (32%)
Skp1 99..151 CDD:396171 23/44 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.980

Return to query results.
Submit another query.