DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and SK6

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_566978.1 Gene:SK6 / 824472 AraportID:AT3G53060 Length:85 Species:Arabidopsis thaliana


Alignment Length:100 Identity:34/100 - (34%)
Similarity:50/100 - (50%) Gaps:20/100 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IKTMLEVSAVENDENAVVPLPKVNAFILNKILTWAYHHKDDDDQAAEGEELTPQSPHDISPWDAN 93
            ||.|.|....:|.    :|||.|.:.||..::.:...|      ..|.:|      .|:..|||.
plant     3 IKGMAEDDCADNG----IPLPNVTSKILLLVIEYCKKH------VVESKE------EDLKKWDAE 51

  Fly    94 FI-NVDQPILFEITVAANYLEIKGLEDLCCKTLAN 127
            |: .::|.|||::.:|||||.|:.|.||   |.:|
plant    52 FMKKMEQSILFDVMMAANYLNIQSLLDL---TFSN 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 28/85 (33%)
Skp1 88..>147 CDD:279768 18/40 (45%)
SK6NP_566978.1 Skp1 <2..73 CDD:214704 28/85 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.