DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and SK6

DIOPT Version :10

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_566978.1 Gene:SK6 / 824472 AraportID:AT3G53060 Length:85 Species:Arabidopsis thaliana


Alignment Length:100 Identity:34/100 - (34%)
Similarity:50/100 - (50%) Gaps:20/100 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IKTMLEVSAVENDENAVVPLPKVNAFILNKILTWAYHHKDDDDQAAEGEELTPQSPHDISPWDAN 93
            ||.|.|....:|.    :|||.|.:.||..::.:...|      ..|.:|      .|:..|||.
plant     3 IKGMAEDDCADNG----IPLPNVTSKILLLVIEYCKKH------VVESKE------EDLKKWDAE 51

  Fly    94 FI-NVDQPILFEITVAANYLEIKGLEDLCCKTLAN 127
            |: .::|.|||::.:|||||.|:.|.||   |.:|
plant    52 FMKKMEQSILFDVMMAANYLNIQSLLDL---TFSN 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 BTB_POZ_SKP1 5..129 CDD:349631 33/99 (33%)
Skp1 115..>153 CDD:460222 4/12 (33%)
SK6NP_566978.1 BTB_POZ 2..80 CDD:453885 32/95 (34%)

Return to query results.
Submit another query.