DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and SK15

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_566773.1 Gene:SK15 / 822152 AraportID:AT3G25650 Length:177 Species:Arabidopsis thaliana


Alignment Length:161 Identity:62/161 - (38%)
Similarity:91/161 - (56%) Gaps:14/161 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAPTIKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENAVVPLPKVNAFILNKILTWAYH 65
            |.:..|.|.||||..|..|...|:..:.:|.:||...|.|:    :||..|...||:.:|.:...
plant     1 MSSNKIVLTSSDGESFQVEEVVARKLQIVKHLLEDDCVINE----IPLQNVTGNILSIVLEYCKK 61

  Fly    66 HKDD--DDQAAEGEELTPQSPHD-----ISPWDANFI-NVDQPILFEITVAANYLEIKGLEDLCC 122
            |.||  ||.|:  ||...:.|.|     :..|||.|: |:|...:|::.:|||||.::||..|.|
plant    62 HVDDVVDDDAS--EEPKKKKPDDEAKQNLDAWDAEFMKNIDMETIFKLILAANYLNVEGLLGLTC 124

  Fly   123 KTLANMIRGKTPEEIRQTFNIEDDLPIDTAE 153
            :|:|:.|:.|||||:|:.||||:|...:..|
plant   125 QTVADYIKDKTPEEVRELFNIENDFTHEEEE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 42/115 (37%)
Skp1 88..>147 CDD:279768 29/59 (49%)
SK15NP_566773.1 SKP1 3..165 CDD:227528 61/159 (38%)
Skp1 3..116 CDD:214704 42/118 (36%)
Skp1 89..165 CDD:279768 31/67 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.940

Return to query results.
Submit another query.