DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and SK10

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_566695.1 Gene:SK10 / 821740 AraportID:AT3G21860 Length:152 Species:Arabidopsis thaliana


Alignment Length:147 Identity:58/147 - (39%)
Similarity:79/147 - (53%) Gaps:14/147 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAPTIKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENAVVPLPKVNAFILNKILTWA-Y 64
            |....|.|:||||..|..|.:||...:||..|.|....:|.    :|||:|...||..::.:. .
plant     1 MSTKKIILKSSDGHSFEVEEEAACQCQTIAHMSEDDCTDNG----IPLPEVTGKILEMVIEYCNK 61

  Fly    65 HHKDDDDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLCCKTLANMI 129
            ||.|    ||     .|.|..|:..||..|:...|..:|::.:|||||.||.|.||.|:|:|:||
plant    62 HHVD----AA-----NPCSDEDLKKWDKEFMEKYQSTIFDLIMAANYLNIKSLLDLACQTVADMI 117

  Fly   130 RGKTPEEIRQTFNIEDD 146
            :..|.|..|:.||||:|
plant   118 KDNTVEHTRKFFNIEND 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 39/108 (36%)
Skp1 88..>147 CDD:279768 28/59 (47%)
SK10NP_566695.1 SKP1 3..149 CDD:227528 57/145 (39%)
Skp1 4..102 CDD:214704 39/110 (35%)
Skp1 76..149 CDD:279768 28/59 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
99.030

Return to query results.
Submit another query.