DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and SK9

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_566694.1 Gene:SK9 / 821739 AraportID:AT3G21850 Length:153 Species:Arabidopsis thaliana


Alignment Length:150 Identity:61/150 - (40%)
Similarity:83/150 - (55%) Gaps:17/150 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAPTIKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVEND--ENAVVPLPKVNAFILNKILTWA 63
            |....|.|:||||..|..|.:||:..:.|...:.    |||  :|. :|||.|...||..::.:.
plant     1 MSTKKIILKSSDGHSFEVEEEAARQCQIIIAHMS----ENDCTDNG-IPLPNVTGKILAMVIEYC 60

  Fly    64 -YHHKDDDDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLCCKTLAN 127
             .||.|    ||     .|.|..|:..||..|:..|...:|::..|||||.||.|.||.|:|:|.
plant    61 NKHHVD----AA-----NPCSDDDLKKWDKEFMEKDTSTIFDLIKAANYLNIKSLFDLACQTVAE 116

  Fly   128 MIRGKTPEEIRQTFNIEDDL 147
            :|:|.|||:||:.||||:||
plant   117 IIKGNTPEQIREFFNIENDL 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 39/110 (35%)
Skp1 88..>147 CDD:279768 29/58 (50%)
SK9NP_566694.1 BTB_POZ_SKP1 5..118 CDD:349631 47/126 (37%)
Skp1 104..151 CDD:366656 19/32 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1010.030

Return to query results.
Submit another query.