DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and SK3

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_565604.1 Gene:SK3 / 817111 AraportID:AT2G25700 Length:163 Species:Arabidopsis thaliana


Alignment Length:151 Identity:61/151 - (40%)
Similarity:90/151 - (59%) Gaps:6/151 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENAVVPLPKVNAFILNKILTWAYHHKDDD 70
            |.|:||||..|..|...|..|:|||.|:|...|:|.    :|||.|...||.|::.:...|.:..
plant     8 IILKSSDGESFEVEEAVAVESQTIKHMIEDDCVDNG----IPLPNVTGAILAKVIEYCKKHVEAA 68

  Fly    71 DQAAEGEELTPQSP-HDISPWDANFINVDQPILFEITVAANYLEIKGLEDLCCKTLANMIRGKTP 134
            .:|...::....:. |::..||.:|:.||.|.||::..|||||.|.||.||.||.:|:.:|||||
plant    69 AEAGGDKDFYGSTENHELKTWDNDFVKVDHPTLFDLLRAANYLNISGLLDLTCKAVADQMRGKTP 133

  Fly   135 EEIRQTFNIEDD-LPIDTAEL 154
            .::|:.|||::| .|.:.||:
plant   134 AQMREHFNIKNDYTPEEEAEV 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 40/108 (37%)
Skp1 88..>147 CDD:279768 31/59 (53%)
SK3NP_565604.1 BTB_POZ_SKP1 7..128 CDD:349631 48/123 (39%)
Skp1 115..161 CDD:396171 20/40 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1010.030

Return to query results.
Submit another query.