DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and SK16

DIOPT Version :10

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_565297.1 Gene:SK16 / 814848 AraportID:AT2G03190 Length:170 Species:Arabidopsis thaliana


Alignment Length:153 Identity:45/153 - (29%)
Similarity:80/153 - (52%) Gaps:11/153 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAPTIKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENAVVPLPKVNAFILNKILTWAYH 65
            |.:..|.|.|||...|..|...|:..:.|..|::    ::..:..:||..|...||..::.:...
plant     1 MSSNKIVLTSSDDESFEVEEAVARKLKVIAHMID----DDCADKAIPLENVTGNILALVIEYCKK 61

  Fly    66 H----KDDDDQAAE--GEELTPQSPHDISPWDANFI-NVDQPILFEITVAANYLEIKGLEDLCCK 123
            |    .||.|.:.|  .|.:..::.:::..|||.|: ..|...:.::.:|.|||.::.|..|.|:
plant    62 HVLDDVDDSDDSTEATSENVNEEAKNELRTWDAEFMKEFDMETVMKLILAVNYLNVQDLLGLTCQ 126

  Fly   124 TLANMIRGKTPEEIRQTFNIEDD 146
            |:|:.::..:|||:|:.||||:|
plant   127 TVADHMKDMSPEEVRELFNIEND 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 BTB_POZ_SKP1 5..129 CDD:349631 35/130 (27%)
Skp1 115..>153 CDD:460222 14/32 (44%)
SK16NP_565297.1 BTB_POZ_SKP1 5..132 CDD:349631 35/130 (27%)
Skp1 118..165 CDD:460222 14/32 (44%)

Return to query results.
Submit another query.