DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and SK14

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_565296.1 Gene:SK14 / 814846 AraportID:AT2G03170 Length:149 Species:Arabidopsis thaliana


Alignment Length:147 Identity:54/147 - (36%)
Similarity:79/147 - (53%) Gaps:17/147 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAPTIKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENAVVPLPKVNAFILNKILTWAYH 65
            |.:..|.|.||||..|..|...|:..:.::.|:|...|..:    |||..|...||:.::.:...
plant     1 MSSNKIVLSSSDGESFEVEEAVARKLKIVEHMIEDDCVVTE----VPLQNVTGKILSIVVEYCKK 61

  Fly    66 HKDDDDQAAEGEELTPQSPHDISPWDANFI-NVDQPILFEITVAANYLEIKGLEDLCCKTLANMI 129
            |..|::.            .:...||..|: ..|||.:|::.:|||||.||||.||..:|:|:.|
plant    62 HVVDEES------------DEFKTWDEEFMKKFDQPTVFQLLLAANYLNIKGLLDLSAQTVADRI 114

  Fly   130 RGKTPEEIRQTFNIEDD 146
            :.|||||||:.||||:|
plant   115 KDKTPEEIREIFNIEND 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 32/108 (30%)
Skp1 88..>147 CDD:279768 33/60 (55%)
SK14NP_565296.1 SKP1 3..147 CDD:227528 53/145 (37%)
Skp1 3..99 CDD:214704 32/111 (29%)
Skp1 72..147 CDD:279768 33/60 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.940

Return to query results.
Submit another query.