DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and skp1

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001016519.1 Gene:skp1 / 549273 XenbaseID:XB-GENE-919631 Length:163 Species:Xenopus tropicalis


Alignment Length:144 Identity:80/144 - (55%)
Similarity:104/144 - (72%) Gaps:2/144 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PTIKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVEND-ENAVVPLPKVNAFILNKILTWAYHHK 67
            |:|||:||||.||..:|:.||.|.|||||||...:::: ::..||||.|||.||.|::.|..|||
 Frog     2 PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHK 66

  Fly    68 DDDDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLCCKTLANMIRGK 132
             ||....|.:|...:...||..||..|:.|||..|||:.:|||||:||||.|:.|||:||||:||
 Frog    67 -DDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGK 130

  Fly   133 TPEEIRQTFNIEDD 146
            ||||||:||||::|
 Frog   131 TPEEIRKTFNIKND 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 54/108 (50%)
Skp1 88..>147 CDD:279768 39/59 (66%)
skp1NP_001016519.1 BTB_POZ_SKP1 4..127 CDD:349631 64/123 (52%)
Skp1 113..160 CDD:396171 24/32 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.