DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and skr-21

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001366771.1 Gene:skr-21 / 54162166 WormBaseID:WBGene00004827 Length:176 Species:Caenorhabditis elegans


Alignment Length:175 Identity:48/175 - (27%)
Similarity:82/175 - (46%) Gaps:39/175 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PTIKLESSDGVIFSTE---VKAAKLSETIKTMLEVSAVENDENAVVPLP---KVNAFILNKILTW 62
            |..|::|.||.:|:.|   ::.:|....:...:        .|.|.|.|   .:.:|:|.||:.|
 Worm     8 PVFKIQSCDGQVFAVEDWFIQKSKCFSVVLAQM--------NNLVQPHPLKTSICSFVLVKIIEW 64

  Fly    63 AYHHKDDDDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLCCKTLAN 127
            .|||:::|...|:         ..::.||..||..:..||..:..||..|||.||.|:.|:.::.
 Worm    65 CYHHRNEDQDHAQ---------RILTAWDVQFIRTNSAILLHLAEAAFRLEIVGLLDVACRAVSI 120

  Fly   128 MIRGKTPEEIR-------------QTFNIED--DLPIDTAELGED 157
            |: |:|..|::             :..::||  :|.:|..|..||
 Worm   121 ML-GRTLNEVKLMLRVGGVESPSDEEDSLEDVLELEVDVDENEED 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 30/113 (27%)
Skp1 88..>147 CDD:279768 21/73 (29%)
skr-21NP_001366771.1 Skp1 7..107 CDD:214704 31/115 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.