DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and skp1

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_957037.1 Gene:skp1 / 393716 ZFINID:ZDB-GENE-040426-1707 Length:163 Species:Danio rerio


Alignment Length:144 Identity:80/144 - (55%)
Similarity:104/144 - (72%) Gaps:2/144 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PTIKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVEND-ENAVVPLPKVNAFILNKILTWAYHHK 67
            |||||:||||.:|..:|:.||.|.|||||||...:::: ::..||||.|||.||.|::.|..|||
Zfish     2 PTIKLQSSDGEMFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHK 66

  Fly    68 DDDDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLCCKTLANMIRGK 132
             ||....|.:|...:...||..||..|:.|||..|||:.:|||||:||||.|:.|||:||||:||
Zfish    67 -DDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGK 130

  Fly   133 TPEEIRQTFNIEDD 146
            ||||||:||||::|
Zfish   131 TPEEIRKTFNIKND 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 53/108 (49%)
Skp1 88..>147 CDD:279768 39/59 (66%)
skp1NP_957037.1 BTB_POZ_SKP1 3..127 CDD:349631 64/124 (52%)
Skp1 113..160 CDD:396171 24/32 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583350
Domainoid 1 1.000 82 1.000 Domainoid score I8343
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.