DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and SkpF

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_611796.1 Gene:SkpF / 37713 FlyBaseID:FBgn0034863 Length:171 Species:Drosophila melanogaster


Alignment Length:144 Identity:76/144 - (52%)
Similarity:103/144 - (71%) Gaps:3/144 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PTIKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENAVVPLPKVNAFILNKILTWAYHHKD 68
            |.|||:||||.||.|:::.||.|.||||:||...||.:.:.::|||.||:.||.|:|.||.||: 
  Fly     2 PVIKLQSSDGEIFETDIETAKCSSTIKTLLEDCPVEAENDTLIPLPNVNSTILKKVLIWAKHHR- 65

  Fly    69 DDDQAAEGEELTPQS-PHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLCCKTLANMIRGK 132
             :|.|.|.||...:| ...|:||||.|:::||..|||:.:|||||:|..|.:..|.|:||||:|:
  Fly    66 -EDIAEENEEEAAKSVAVQITPWDAEFLSMDQGTLFELILAANYLDIPNLLNAACMTVANMIKGR 129

  Fly   133 TPEEIRQTFNIEDD 146
            |.|||||||:|.:|
  Fly   130 TTEEIRQTFHITND 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 56/108 (52%)
Skp1 88..>147 CDD:279768 34/59 (58%)
SkpFNP_611796.1 SKP1 1..157 CDD:227528 76/144 (53%)
Skp1 1..111 CDD:214704 57/110 (52%)
Skp1 87..157 CDD:279768 33/57 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452335
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - otm46619
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
1110.850

Return to query results.
Submit another query.