DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and Skp1

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:XP_038941314.1 Gene:Skp1 / 287280 RGDID:1359648 Length:165 Species:Rattus norvegicus


Alignment Length:147 Identity:82/147 - (55%)
Similarity:105/147 - (71%) Gaps:2/147 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAPTIKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVEND-ENAVVPLPKVNAFILNKILTWAY 64
            |..|||||:||||.||..:|:.||.|.|||||||...:::: ::..||||.|||.||.|::.|..
  Rat     1 MQMPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCT 65

  Fly    65 HHKDDDDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLCCKTLANMI 129
            ||| ||....|.:|...:...||..||..|:.|||..|||:.:|||||:||||.|:.|||:||||
  Rat    66 HHK-DDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMI 129

  Fly   130 RGKTPEEIRQTFNIEDD 146
            :||||||||:||||::|
  Rat   130 KGKTPEEIRKTFNIKND 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 54/108 (50%)
Skp1 88..>147 CDD:279768 39/59 (66%)
Skp1XP_038941314.1 BTB_POZ_SKP1 5..129 CDD:349631 65/124 (52%)
Skp1 115..162 CDD:396171 24/32 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343138
Domainoid 1 1.000 83 1.000 Domainoid score I8137
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X346
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.820

Return to query results.
Submit another query.