DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and skr-18

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_741300.1 Gene:skr-18 / 260116 WormBaseID:WBGene00018935 Length:183 Species:Caenorhabditis elegans


Alignment Length:144 Identity:43/144 - (29%)
Similarity:81/144 - (56%) Gaps:7/144 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENA-VVPLP-KVNAFILNKILTWAYHHKD 68
            ::|.||:|.:...:::|.:||.||.|.::....:.::.| :.|:| ..:.:.|:.::.|...||.
 Worm    29 LQLASSNGEVLQADIRALQLSSTISTTIKELGYDKEDCAEIKPIPVDEHEYTLDLLIKWCDQHKG 93

  Fly    69 DDDQAAEGEELTPQSPHDISPWDANFINVDQPI--LFEITVAANYLEIKGLEDLCCKTLANMIRG 131
            ||.:.|:.|:  .:....|..||.:|.:| .|:  |..:..||..|:|.||.:...:|:|:.|.|
 Worm    94 DDPEIAKAEK--GKKKVVIPSWDQHFFSV-LPMGNLLAVIKAAYDLDITGLVNYGTQTVASRING 155

  Fly   132 KTPEEIRQTFNIED 145
            |:.||:|:.|.:.:
 Worm   156 KSAEEMREIFQLPE 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 31/111 (28%)
Skp1 88..>147 CDD:279768 21/60 (35%)
skr-18NP_741300.1 BTB_POZ 28..153 CDD:365784 36/126 (29%)
Skp1 140..>169 CDD:366656 11/28 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160666
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.