DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and skp1

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_595455.1 Gene:skp1 / 2540917 PomBaseID:SPBC409.05 Length:161 Species:Schizosaccharomyces pombe


Alignment Length:150 Identity:70/150 - (46%)
Similarity:93/150 - (62%) Gaps:6/150 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLESSDGVIFSTEVKAAKLSETIKTMLE-VSAVENDENAVVPLPKVNAFILNKILTWAYHHKDD 69
            |||.|||...|..:...|:.|..||.||| |..:    |..:|||.|::.:|.|:|.|..|||:|
pombe     4 IKLISSDNEEFVVDQLIAERSMLIKNMLEDVGEI----NVPIPLPNVSSNVLRKVLEWCEHHKND 64

  Fly    70 DDQAAEGE-ELTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLCCKTLANMIRGKT 133
            .....|.| ::..:...||..||..|:.|||.:||||.:|:|||:||.|.|..|||:|||||||:
pombe    65 LYSGTEEESDIRLKKSTDIDEWDRKFMAVDQEMLFEIVLASNYLDIKPLLDTGCKTVANMIRGKS 129

  Fly   134 PEEIRQTFNIEDDLPIDTAE 153
            ||:||:||||.:|...:..|
pombe   130 PEDIRKTFNIPNDFTPEEEE 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 46/109 (42%)
Skp1 88..>147 CDD:279768 36/58 (62%)
skp1NP_595455.1 SKP1 1..161 CDD:227528 69/149 (46%)
Skp1 1..110 CDD:214704 46/109 (42%)
Skp1 84..158 CDD:279768 37/65 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 61 1.000 Domainoid score I2981
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.