DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and SPBC1861.07

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_596724.1 Gene:SPBC1861.07 / 2539714 PomBaseID:SPBC1861.07 Length:97 Species:Schizosaccharomyces pombe


Alignment Length:116 Identity:31/116 - (26%)
Similarity:49/116 - (42%) Gaps:23/116 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAPTIKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENAVVPLPKVNAFILNKI---LTW 62
            |:...::|.|.||.:|..|.:.|.||.||:.:|........:......|.:.|.:|.|:   |.:
pombe     1 MEKEYVRLISGDGFVFILEKEIACLSGTIRAILNEGIFSEAQKNECTFPDIRATLLEKVCEYLHY 65

  Fly    63 AYHHKDDDDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLE 113
            .|.:|:..|        .|:  .||.|          .::.|:.|.|.|||
pombe    66 NYRYKNQLD--------IPK--FDIPP----------EMVLELLVTAEYLE 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 30/111 (27%)
Skp1 88..>147 CDD:279768 7/26 (27%)
SPBC1861.07NP_596724.1 Skp1 3..96 CDD:214704 28/112 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.