DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and elc-2

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001362016.1 Gene:elc-2 / 24104987 WormBaseID:WBGene00001237 Length:141 Species:Caenorhabditis elegans


Alignment Length:114 Identity:27/114 - (23%)
Similarity:46/114 - (40%) Gaps:28/114 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLESSDGVIFSTEVKAAKLSETIKTM-----LEVSAVENDENAVVPLPKVNAFILNKILTW-AY 64
            :||.|:|...|..:.:.|..|::::.:     ::::|..|    .|......:.||.|:..: ||
 Worm    49 VKLVSNDDHEFIIKREVAMTSKSLRELFANPTVDLAAANN----TVYFSDFQSHILQKVCHYLAY 109

  Fly    65 HHKDDDDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLE 113
            ..|....:.|        .|.||.|          .|..::..|||.||
 Worm   110 KTKYRHSRVA--------PPFDIPP----------DIAMDLLAAANELE 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 27/114 (24%)
Skp1 88..>147 CDD:279768 7/26 (27%)
elc-2NP_001362016.1 BTB_POZ_EloC 48..141 CDD:349630 27/114 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.