DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and skr-4

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_507857.1 Gene:skr-4 / 191762 WormBaseID:WBGene00004810 Length:159 Species:Caenorhabditis elegans


Alignment Length:140 Identity:60/140 - (42%)
Similarity:86/140 - (61%) Gaps:8/140 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENAVVPLPKVNAFILNKILTWAYHHKDDD 70
            |||.|||...|:...|....|:||      |...:::  .:|||||.:.||.||:||..||.||:
 Worm    10 IKLISSDDKTFTVSRKVISQSKTI------SGFTSED--TIPLPKVTSAILEKIITWCEHHADDE 66

  Fly    71 DQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLCCKTLANMIRGKTPE 135
            .:..|..|...:...:||.|||.|:.|||..||||.:|||||:|:||.::..:.:|||::||||.
 Worm    67 PKKVEKIEKGNKKTVEISEWDAEFMKVDQGTLFEIILAANYLDIRGLLEVTTQNVANMMKGKTPS 131

  Fly   136 EIRQTFNIED 145
            ::|..|.|::
 Worm   132 QVRTLFKIDN 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 47/107 (44%)
Skp1 88..>147 CDD:279768 30/58 (52%)
skr-4NP_507857.1 Skp1 7..110 CDD:214704 47/107 (44%)
SKP1 10..159 CDD:227528 60/140 (43%)
Skp1 84..157 CDD:279768 30/58 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160672
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.770

Return to query results.
Submit another query.