DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and skr-20

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_510192.1 Gene:skr-20 / 181445 WormBaseID:WBGene00004826 Length:173 Species:Caenorhabditis elegans


Alignment Length:150 Identity:49/150 - (32%)
Similarity:75/150 - (50%) Gaps:14/150 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 APTIKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENA------VVPLPKVNAFILNKILT 61
            ||..||:|.||.||:.|....|....|........| ||.|.      :||.   ::.|:..::.
 Worm     7 APLYKLKSEDGQIFNVERGPMKFCAFINQKFIDHGV-NDRNCERADPILVPF---HSSIVQAVIE 67

  Fly    62 WAYHHKDDDDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLCCKTLA 126
            |.||:: |:..|....::   ..||.|.||..|.||:..:||.:..|::.|.::.|.::.|...|
 Worm    68 WLYHYQ-DNPLARRDSKI---RYHDFSEWDKQFFNVESGVLFALLNASHALGVEDLMNMGCAAAA 128

  Fly   127 NMIRGKTPEEIRQTFNIEDD 146
            .:||||:.||||:.:.|..|
 Worm   129 ELIRGKSTEEIRKIYGIRSD 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 34/113 (30%)
Skp1 88..>147 CDD:279768 22/58 (38%)
skr-20NP_510192.1 Skp1 7..116 CDD:214704 36/116 (31%)
Skp1 90..154 CDD:279768 22/58 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160657
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.