DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and skr-7

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_504221.1 Gene:skr-7 / 178840 WormBaseID:WBGene00004813 Length:194 Species:Caenorhabditis elegans


Alignment Length:164 Identity:55/164 - (33%)
Similarity:88/164 - (53%) Gaps:21/164 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DAPTI-----KLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENAVVPLP--KVNAFILNKI 59
            :||.:     |:|||||.::....:|.|.|.|:..::. :.|.||..::.|:|  .|...|:..:
 Worm    14 EAPIVAPIMYKVESSDGQVYEISDEAVKQSNTLSNLIS-TCVANDVASMDPIPITNVTGNIMKMV 77

  Fly    60 LTWAYHHKDDDDQAAEGEELTPQS---PHDIS--PWDANFINVDQPILFEITVAANYLEIKGLED 119
            :.|...||        ||.|..:.   |.:|:  .||.||:.:|..:||::.||:|:|::.||..
 Worm    78 IEWCEKHK--------GETLPVEDDSVPKNITVPEWDTNFLKIDNDVLFDLIVASNFLDVPGLMS 134

  Fly   120 LCCKTLANMIRGKTPEEIRQTFNIEDDLPIDTAE 153
            ..||.:|||..||:|:|:|..|.|..|...:.||
 Worm   135 YACKMVANMAIGKSPDEMRVLFAIPTDEEDEAAE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 36/119 (30%)
Skp1 88..>147 CDD:279768 25/60 (42%)
skr-7NP_504221.1 Skp1 20..129 CDD:214704 36/117 (31%)
Skp1 103..>160 CDD:279768 25/56 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160674
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.