DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and skr-14

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_504220.4 Gene:skr-14 / 178839 WormBaseID:WBGene00004820 Length:168 Species:Caenorhabditis elegans


Alignment Length:164 Identity:56/164 - (34%)
Similarity:85/164 - (51%) Gaps:17/164 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DAPT----IKLESSDGVIFSTEVKAAKLSETIKTMLE--VSAVENDENA-VVPLPKVNAFILNKI 59
            |||.    .|:.|:|||:.....||.:.|:|:..::|  ...:||.|.. .:|:..||...:.|:
 Worm     7 DAPAAQIFYKIISNDGVVTKMSEKAVQQSKTLSNLIENLGYTIENIETRDPIPVTNVNGKTMEKV 71

  Fly    60 LTWAYHHKDD---DDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLC 121
            ..|...|..|   :|.....:.||      |..||..|:.::...||::.:|:|:|:||||....
 Worm    72 AEWCEKHNADAIPEDNMNVLKTLT------IPEWDQKFLKIEDEALFDLILASNFLDIKGLMYYG 130

  Fly   122 CKTLANMIRGKTPEEIRQTFNIEDDLPIDTAELG 155
            |||::||.:|||..|:|:.|.|..| ..|.||.|
 Worm   131 CKTVSNMAKGKTTAELREIFGINTD-EQDAAEGG 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 32/113 (28%)
Skp1 88..>147 CDD:279768 24/58 (41%)
skr-14NP_504220.4 Skp1 12..123 CDD:214704 32/116 (28%)
Skp1 97..161 CDD:279768 26/64 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160664
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.