DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and skr-12

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001367151.1 Gene:skr-12 / 178496 WormBaseID:WBGene00004818 Length:172 Species:Caenorhabditis elegans


Alignment Length:166 Identity:57/166 - (34%)
Similarity:88/166 - (53%) Gaps:19/166 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAP----TIKLESSDGVIFSTEVKAAKLSETIKTMLE--VSAVENDENA-VVPLPKVNAFILNK 58
            :|||    ..|:.|||||:.....||.:.|:|:..::|  ...:||.|.. .:|:..||...:.|
 Worm     6 VDAPAAEIVYKIISSDGVVSKMSEKAVQQSKTLSNLIENLGYTIENIETRDPIPVTNVNGKTMAK 70

  Fly    59 ILTWAYHHKDD---DDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDL 120
            :..|...||.|   :|.....:.||      |..||..|:.::...||::.:|:|:|:||||...
 Worm    71 VAEWCEKHKADAIPEDNMNVLKTLT------IPEWDQKFLKIEDEALFDLILASNFLDIKGLMYF 129

  Fly   121 CCKTLANMIRGKTPEEIRQTFNI---EDDLPIDTAE 153
            .|||::||.:|||..|:|:.|.|   |.|...:||:
 Worm   130 GCKTVSNMAKGKTTAELREIFGINTDEQDAAEETAQ 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 34/113 (30%)
Skp1 88..>147 CDD:279768 25/61 (41%)
skr-12NP_001367151.1 BTB_POZ_SKP1 14..138 CDD:349631 42/129 (33%)
Skp1 124..161 CDD:396171 17/36 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160667
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.