DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and skr-13

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_503042.1 Gene:skr-13 / 178493 WormBaseID:WBGene00004819 Length:172 Species:Caenorhabditis elegans


Alignment Length:165 Identity:56/165 - (33%)
Similarity:86/165 - (52%) Gaps:19/165 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DAP----TIKLESSDGVIFSTEVKAAKLSETIKTMLE--VSAVENDENA-VVPLPKVNAFILNKI 59
            |||    ..|:.|||||:.....||.:.|:|:..::|  ...:||.|.. .:|:..||...:.|:
 Worm     7 DAPAAEIVYKIISSDGVVSKMSEKAVQQSKTLSNLIENLGYTIENIETRDPIPVTNVNGKTMAKV 71

  Fly    60 LTWAYHHKDD---DDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLC 121
            ......||.|   :|.....:.||      |..||..|:.::...||::.:|:|:|:||||....
 Worm    72 AELCEKHKADAIPEDNMNVLKTLT------IPEWDQKFLKIEDEALFDLILASNFLDIKGLMYYG 130

  Fly   122 CKTLANMIRGKTPEEIRQTFNI---EDDLPIDTAE 153
            |||::||.:|||..|:|:.|.|   |.|...:||:
 Worm   131 CKTVSNMAKGKTTAELREIFGINTDEQDAAEETAQ 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 33/113 (29%)
Skp1 88..>147 CDD:279768 25/61 (41%)
skr-13NP_503042.1 Skp1 12..123 CDD:214704 33/116 (28%)
SKP1 16..166 CDD:227528 53/156 (34%)
Skp1 97..161 CDD:279768 26/63 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160658
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.