DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpD and skr-10

DIOPT Version :9

Sequence 1:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_502902.1 Gene:skr-10 / 178447 WormBaseID:WBGene00004816 Length:192 Species:Caenorhabditis elegans


Alignment Length:158 Identity:54/158 - (34%)
Similarity:83/158 - (52%) Gaps:15/158 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 APTI-KLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENAVVPLP--KVNAFILNKILTWAY 64
            ||.: |:||:||.:|....:|.|.|.|:..::...|.| |..::.|:|  .|...||..::.|..
 Worm    17 APIMYKVESNDGTVFEISDEAVKQSNTLSNLISTCAPE-DVASMDPIPITNVTGNILKMVIEWCE 80

  Fly    65 HHKDD----DDQAAEGEELTPQSPHDISPWDANFINVDQPILFEITVAANYLEIKGLEDLCCKTL 125
            .||.:    ||.:.......|:       ||.||:.:|..:||::.||.|||::.||.:..||.:
 Worm    81 KHKGEALPVDDDSVPKHITVPE-------WDTNFLKIDNEVLFDLIVACNYLDVPGLMNYGCKMV 138

  Fly   126 ANMIRGKTPEEIRQTFNIEDDLPIDTAE 153
            |.|..||:|:|:|..|.|..|...:.||
 Worm   139 AMMAIGKSPDELRIIFAIPTDEEDEAAE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpDNP_608357.2 Skp1 6..114 CDD:214704 36/114 (32%)
Skp1 88..>147 CDD:279768 25/58 (43%)
skr-10NP_502902.1 Skp1 18..127 CDD:214704 37/116 (32%)
Skp1 101..>159 CDD:279768 26/64 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160661
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54148
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.